PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_05951
Common NameKK1_006100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family NF-YB
Protein Properties Length: 193aa    MW: 21908 Da    PI: 7.2812
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_05951genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB128.23e-4025119296
          NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 
                    ++++r+lPia v r+++kvlP+n+k+s+++ke + ecv+efisf+t ea++kc++e+rkti+++dl++a+ +lGfe y++ l  yl++yr+ +++
  C.cajan_05951  25 KQENRYLPIACVHRLIRKVLPKNTKVSDESKEKIMECVTEFISFITVEANHKCKEEQRKTITAEDLIHAMDKLGFEPYAKLLLFYLHRYRQHHQA 119
                    689***************************************************************************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.8E-3820121IPR009072Histone-fold
SuperFamilySSF471133.73E-3027120IPR009072Histone-fold
PfamPF008085.4E-203094IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006155.4E-115876No hitNo description
PRINTSPR006155.4E-117795No hitNo description
PRINTSPR006155.4E-1196114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MIIDKSWCVL DSKGEGNSSN GEEQKQENRY LPIACVHRLI RKVLPKNTKV SDESKEKIME  60
CVTEFISFIT VEANHKCKEE QRKTITAEDL IHAMDKLGFE PYAKLLLFYL HRYRQHHQAN  120
QVPHRAPLSL PALPTIANYA HAVLPPPPQP FLPFPNPTMD AFYGDASINI GANINVNYDN  180
AAYFNAHNFF GGN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B2e-3025115292Transcription factor HapC (Eurofung)
4g91_B2e-3025115292Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ84W665e-36NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLA0A151U2F11e-145A0A151U2F1_CAJCA; Nuclear transcription factor Y subunit B-6
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27283279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.22e-37nuclear factor Y, subunit B6